PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G077200.1.p
Common NameSb10g006690, SB35P03.4, SORBIDRAFT_10g006690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRF
Protein Properties Length: 339aa    MW: 35944.3 Da    PI: 9.7332
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G077200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.71e-2385128144
                   WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                           d+epgrCrRtDGKkWRCsr++ + +k+CE+H+hrg+srsrk++e
  Sobic.010G077200.1.p  85 DPEPGRCRRTDGKKWRCSREAHGESKYCEKHIHRGKSRSRKPVE 128
                           79***************************************998 PP

2QLQ59.69.2e-211246236
                   QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                           FTa+Q+q+L++Q+l++Ky+a+++PvP++L+++++
  Sobic.010G077200.1.p 12 LFTASQWQELEHQALIFKYMASGAPVPHDLVLPLR 46
                          5*******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.5E-91147IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.8751247IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.4E-151345IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.94485129IPR014977WRC domain
PfamPF088795.3E-1986128IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MMLSGHGGGR RLFTASQWQE LEHQALIFKY MASGAPVPHD LVLPLRLATG VDTAPSLAFP  60
PQPSPSLAYW GCYGAGAPFG RKAEDPEPGR CRRTDGKKWR CSREAHGESK YCEKHIHRGK  120
SRSRKPVEVT SPAAAAYRPS ALSISPPRAA DAPPPSLAHP HQHLRHGAAS AAAAARGAPG  180
QATAGALQLH LDASLHAASP PPSYHRYAHS HAHYTPPPSL FPGGGGGYDY GQSKELREAE  240
LRRRHFHALG ADLSLDKPLA ATAAGSAAAE KPLRRFFDEW PRESGDTRPS SWAGAEDATQ  300
LSISIPAASP SDLAASAAAR YHNGEPSGER KTPLLLVP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.42541e-37root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4661990.0AF466199.1 Sorghum bicolor putative receptor protein kinase, aminoalcoholphosphotransferase, putative growth-regulating factor 1, putative GAG-POL precursor, putative GAG-POL precursor, putative RIRE2 orf3, putative anthocyanin regulatory C1, putative protein T30F21.6, putative copia polyprotein, putative copia polyprotein, putative protein NP_196765.1, and gb protein genes, complete cds; and putative zinc finger protein gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436657.10.0hypothetical protein SORBIDRAFT_10g006690
SwissprotQ6AWY75e-95GRF2_ORYSJ; Growth-regulating factor 2
TrEMBLQ8W0U70.0Q8W0U7_SORBI; Putative growth-regulating factor 1
STRINGSb10g006690.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139922527
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.16e-41growth-regulating factor 5
Publications ? help Back to Top
  1. Swigonov
    Close split of sorghum and maize genome progenitors.
    Genome Res., 2004. 14(10A): p. 1916-23
    [PMID:15466289]
  2. Lai J, et al.
    Gene loss and movement in the maize genome.
    Genome Res., 2004. 14(10A): p. 1924-31
    [PMID:15466290]